PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9KG110800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 719aa    MW: 81446.7 Da    PI: 6.4759
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9KG110800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS333.44e-1023457151374
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          l++lL++cA+avs ++++la+ +L+ +++++s +gd +qRla++++  L+arl +++s+ly++l ++  +    +  l++++l   v P+
  Pavir.9KG110800.1.p 345 LRTLLIHCAQAVSVSNHTLASDILNIIRQNCSISGDDTQRLASCLADSLEARLDGTGSQLYQKLITKCRN---AVGFLKVFQLSLAVNPF 431
                          6789*********************************************************999988887...899************** PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                              +   N++Ile ++g+++vHiiDf+i  G+QWp+L+++L++R++gpp++RiTg+++p +g    ++ ++tg+rLa++A+ ++vpfe+
  Pavir.9KG110800.1.p 432 QMAPFHFSNKTILEVTKGKRKVHIIDFGICFGFQWPSLFEQLTKREDGPPKVRITGIEQPLPGfrPDQMNRNTGHRLAEYASMFNVPFEY 521
                          ************************************************************99999999999******************* PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                          +  +++++e++++e++++++ ++l+Vn+ +++++l de+vs++s+r++vL++++ ++Pkv+v+   + +++++ Fl+rf e +++ysalf
  Pavir.9KG110800.1.p 522 QG-ISSKWETIRIEDFHIEEVDVLIVNCLYRMEHLGDETVSVNSARNKVLDTIRMTKPKVFVHGVVNGSYSAPFFLTRFKEVMYHYSALF 610
                          **.7************************************************************************************** PP

                 GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgsl 358
                          d le+++pr++e+r+ +Er +   +i nv+aceg+er+er e+++kW++r  +aG++++pl+ +++k  + ++ ++++d + v e++++l
  Pavir.9KG110800.1.p 611 DILEKTVPRDNEARMILERDIYLCSILNVIACEGSERIERPENYKKWKSRNLKAGLEQLPLNPDIVKVTRDVVGQYHKD-FVVGEDDQWL 699
                          *****************************************************************************77.********** PP

                 GRAS 359 vlgWkdrpLvsvSaWr 374
                          +lgWk+r L ++S W+
  Pavir.9KG110800.1.p 700 LLGWKGRILKAISTWK 715
                          ***************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.994319696IPR005202Transcription factor GRAS
PfamPF035141.4E-99345715IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 719 aa     Download sequence    Send to blast
MEFNDKSSTN FEDFSSSMSS TSGSYAPSHE FVDPANESND LKLFLHPPSS SNYYPPVSST  60
ANDEGHITSN TSYSSKTCAP QFCEVSSHVT PDWYGISVAD SSKSSWVNSD ITINYINKLL  120
MQEDNDDKVK LHHGEYALRA MEEPFYRLLG QSRPAYPLLP LCSCDHLNNL DGCMKSSGQS  180
CSSCSDYIDP TNNHPNHDLQ AVEAPWSLSD IVKETEHFAQ GTHSMDVDGL SIAEERSRDK  240
QLNVADKRLH ESSEVQCQND PHTEDFCLLE GRSRKQLAVS FNGPTRDEMF DRVLLFSEHK  300
PMDEGIVLRE KGTNKSTHQK DQGRASSARR RTRGKKQQNK EVVDLRTLLI HCAQAVSVSN  360
HTLASDILNI IRQNCSISGD DTQRLASCLA DSLEARLDGT GSQLYQKLIT KCRNAVGFLK  420
VFQLSLAVNP FQMAPFHFSN KTILEVTKGK RKVHIIDFGI CFGFQWPSLF EQLTKREDGP  480
PKVRITGIEQ PLPGFRPDQM NRNTGHRLAE YASMFNVPFE YQGISSKWET IRIEDFHIEE  540
VDVLIVNCLY RMEHLGDETV SVNSARNKVL DTIRMTKPKV FVHGVVNGSY SAPFFLTRFK  600
EVMYHYSALF DILEKTVPRD NEARMILERD IYLCSILNVI ACEGSERIER PENYKKWKSR  660
NLKAGLEQLP LNPDIVKVTR DVVGQYHKDF VVGEDDQWLL LGWKGRILKA ISTWKPND*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-363497158375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008665058.10.0PREDICTED: scarecrow-like protein 34 isoform X2
TrEMBLK4AMS50.0K4AMS5_SETIT; Uncharacterized protein
STRINGSi040221m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP117882640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-146GRAS family protein